PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014142m
Common NameEUTSA_v10014142mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SRS
Protein Properties Length: 317aa    MW: 33135.3 Da    PI: 8.5665
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014142mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702211.52e-651062663154
           DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                      sgta+CqdCGnqakk+C+++RCRtCCksrgf+C+thvkstWv+aa+rrerq   +a  +  ++ ++++ +k++r +  ++q+a+s+t++s++ +
  Thhalv10014142m 106 SGTATCQDCGNQAKKECKQRRCRTCCKSRGFECSTHVKSTWVSAARRRERQVLPTANPTAGSSLSTSSGTKKPRIM-GSQQQATSHTSTSNT-P 197
                      7899**********************************************99888887777777789999999986.677777888887776.6 PP

           DUF702  97 kkeletss...........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      +++++tss           +P +v+++avf+cvrv++v+dg++e+aYq++v+igGhvfkG+LydqGle 
  Thhalv10014142m 198 PQSFDTSSsrqdgggsreaWPGQVKAAAVFKCVRVTAVEDGDDEYAYQAVVQIGGHVFKGFLYDQGLEP 266
                      77888887899*******************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.5E-59108265IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.1E-26110152IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.2E-30216264IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGMVGLRDVY LVAPAYHHHQ NAGVVSGSDH INSNAAALGV GVIPLLTAAP PQQNVEDTDI  60
NFLGDSRRWQ NNNNNNQTQY LQFKSTTHQA TVGSSSNNSG SGSAASGTAT CQDCGNQAKK  120
ECKQRRCRTC CKSRGFECST HVKSTWVSAA RRRERQVLPT ANPTAGSSLS TSSGTKKPRI  180
MGSQQQATSH TSTSNTPPQS FDTSSSRQDG GGSREAWPGQ VKAAAVFKCV RVTAVEDGDD  240
EYAYQAVVQI GGHVFKGFLY DQGLEPKEGF PNMSDLHLGG GGGANNHNGV SASPPVLDPP  300
NVYGGRGGGA GGGFYG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399749.10.0hypothetical protein EUTSA_v10014142mg
SwissprotQ94CK91e-163LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLV4LFK60.0V4LFK6_EUTSA; Uncharacterized protein
STRINGBra008898.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58832646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-143Lateral root primordium (LRP) protein-related